Lineage for d2di4b_ (2di4 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351788Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
    array of 6 helices and a 2-stranded beta-ribbon
  4. 2351789Superfamily a.269.1: FtsH protease domain-like [140990] (1 family) (S)
    contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold
    automatically mapped to Pfam PF01434
  5. 2351790Family a.269.1.1: FtsH protease domain-like [140991] (2 proteins)
    Pfam PF01434; Peptidase family M41
  6. 2351791Protein Cell division protein FtsH, C-terminal domain [140992] (2 species)
  7. 2351792Species Aquifex aeolicus [TaxId:63363] [140993] (1 PDB entry)
    Uniprot O67077 406-607
  8. 2351794Domain d2di4b_: 2di4 B: [131523]
    automated match to d2di4a1
    complexed with hg

Details for d2di4b_

PDB Entry: 2di4 (more details), 2.79 Å

PDB Description: Crystal structure of the FtsH protease domain
PDB Compounds: (B:) Cell division protein ftsH homolog

SCOPe Domain Sequences for d2di4b_:

Sequence, based on SEQRES records: (download)

>d2di4b_ a.269.1.1 (B:) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
ispkekekiaiheaghalmglvsddddkvhkisiiprgmalgvtqqlpiedkhiydkkdl
ynkilvllggraaeevffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrva
npflggmttavdtspdllreideevkriiteqyekakaiveeykeplkavvkklleketi
tceefvevfklygielkdkck

Sequence, based on observed residues (ATOM records): (download)

>d2di4b_ a.269.1.1 (B:) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
ispkekekiaiheaghalmglvsddddkvhkisiiphiydkkdlynkilvllggraaeev
ffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrtavdtspdllreideevk
riiteqyekakaiveeykeplkavvkklleketitceefvevfklygielkdkck

SCOPe Domain Coordinates for d2di4b_:

Click to download the PDB-style file with coordinates for d2di4b_.
(The format of our PDB-style files is described here.)

Timeline for d2di4b_: