SCOPe 2.02: Domain d2di4b1: 2di4 B:407-607

Lineage for d2di4b1 (2di4 B:407-607)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
   array of 6 helices and a 2-stranded beta-ribbon

4. Superfamily a.269.1: FtsH protease domain-like [140990] (1 family)
   contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold

5. Family a.269.1.1: FtsH protease domain-like [140991] (1 protein)
   Pfam PF01434; Peptidase family M41

6. Protein Cell division protein FtsH, C-terminal domain [140992] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [140993] (1 PDB entry)
   Uniprot O67077 406-607

8. Domain d2di4b1: 2di4 B:407-607 [131523]
   automatically matched to 2DI4 A:406-607
   complexed with hg

Details for d2di4b1

PDB Entry: 2di4, 2.79 Å

PDB Description: Crystal structure of the FtsH protease domain

PDB Compounds: (B:) Cell division protein ftsH homolog

SCOPe Domain Sequences for d2di4b1:

Sequence, based on SEQRES records:

>d2di4b1 a.269.1.1 (B:407-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
ispkekekiaiheaghalmglvsddddkvhkisiiprgmalgvtqqlpiedkhiydkkdl
ynkilvllggraaeevffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrva
npflggmttavdtspdllreideevkriiteqyekakaiveeykeplkavvkklleketi
tceefvevfklygielkdkck

Sequence, based on observed residues (ATOM records):

>d2di4b1 a.269.1.1 (B:407-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
ispkekekiaiheaghalmglvsddddkvhkisiiphiydkkdlynkilvllggraaeev
ffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrtavdtspdllreideevk
riiteqyekakaiveeykeplkavvkklleketitceefvevfklygielkdkck

Timeline for d2di4b1:

• d2di4b1 first appeared in SCOP 1.73
  
• d2di4b1 appears in SCOPe 2.01
  
• d2di4b1 is called d2di4b_ in SCOPe 2.03
  
• d2di4b1 appears in the current release, SCOPe 2.08, called d2di4b_