Lineage for d2di4b1 (2di4 B:407-607)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781161Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
    array of 6 helices and a 2-stranded beta-ribbon
  4. 781162Superfamily a.269.1: FtsH protease domain-like [140990] (1 family) (S)
    contains zincin-like ((55486)) metal-binding motif HExxH, embedded into a topologically different fold
  5. 781163Family a.269.1.1: FtsH protease domain-like [140991] (1 protein)
    Pfam PF01434; Peptidase family M41
  6. 781164Protein Cell division protein FtsH, C-terminal domain [140992] (2 species)
  7. 781165Species Aquifex aeolicus [TaxId:63363] [140993] (1 PDB entry)
    Uniprot O67077 406-607
  8. 781167Domain d2di4b1: 2di4 B:407-607 [131523]
    automatically matched to 2DI4 A:406-607
    complexed with hg

Details for d2di4b1

PDB Entry: 2di4 (more details), 2.79 Å

PDB Description: Crystal structure of the FtsH protease domain
PDB Compounds: (B:) Cell division protein ftsH homolog

SCOP Domain Sequences for d2di4b1:

Sequence, based on SEQRES records: (download)

>d2di4b1 a.269.1.1 (B:407-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
ispkekekiaiheaghalmglvsddddkvhkisiiprgmalgvtqqlpiedkhiydkkdl
ynkilvllggraaeevffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrva
npflggmttavdtspdllreideevkriiteqyekakaiveeykeplkavvkklleketi
tceefvevfklygielkdkck

Sequence, based on observed residues (ATOM records): (download)

>d2di4b1 a.269.1.1 (B:407-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
ispkekekiaiheaghalmglvsddddkvhkisiiphiydkkdlynkilvllggraaeev
ffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrtavdtspdllreideevk
riiteqyekakaiveeykeplkavvkklleketitceefvevfklygielkdkck

SCOP Domain Coordinates for d2di4b1:

Click to download the PDB-style file with coordinates for d2di4b1.
(The format of our PDB-style files is described here.)

Timeline for d2di4b1: