Lineage for d2di4a1 (2di4 A:406-607)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738840Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
    array of 6 helices and a 2-stranded beta-ribbon
  4. 2738841Superfamily a.269.1: FtsH protease domain-like [140990] (1 family) (S)
    contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold
    automatically mapped to Pfam PF01434
  5. 2738842Family a.269.1.1: FtsH protease domain-like [140991] (2 proteins)
    Pfam PF01434; Peptidase family M41
  6. 2738843Protein Cell division protein FtsH, C-terminal domain [140992] (2 species)
  7. 2738844Species Aquifex aeolicus [TaxId:63363] [140993] (1 PDB entry)
    Uniprot O67077 406-607
  8. 2738845Domain d2di4a1: 2di4 A:406-607 [131522]
    complexed with hg

Details for d2di4a1

PDB Entry: 2di4 (more details), 2.79 Å

PDB Description: Crystal structure of the FtsH protease domain
PDB Compounds: (A:) Cell division protein ftsH homolog

SCOPe Domain Sequences for d2di4a1:

Sequence, based on SEQRES records: (download)

>d2di4a1 a.269.1.1 (A:406-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
tispkekekiaiheaghalmglvsddddkvhkisiiprgmalgvtqqlpiedkhiydkkd
lynkilvllggraaeevffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrv
anpflggmttavdtspdllreideevkriiteqyekakaiveeykeplkavvkklleket
itceefvevfklygielkdkck

Sequence, based on observed residues (ATOM records): (download)

>d2di4a1 a.269.1.1 (A:406-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
tispkekekiaiheaghalmglvsddddkvhkisiikhiydkkdlynkilvllggraaee
vffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrtavdtspdllreideev
kriiteqyekakaiveeykeplkavvkklleketitceefvevfklygielkdkck

SCOPe Domain Coordinates for d2di4a1:

Click to download the PDB-style file with coordinates for d2di4a1.
(The format of our PDB-style files is described here.)

Timeline for d2di4a1: