SCOPe 2.06: Domain d2di0a1: 2di0 A:8-70

Lineage for d2di0a1 (2di0 A:8-70)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.4: CUE domain [88995] (4 proteins)
   Pfam PF02845

6. Protein Activating signal cointegrator 1 complex subunit 2 [140346] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140347] (1 PDB entry)
   Uniprot Q9H1I8 463-525

8. Domain d2di0a1: 2di0 A:8-70 [131521]
   Other proteins in same PDB: d2di0a2

Details for d2di0a1

PDB Entry: 2di0

PDB Description: solution structure of the cue domain in the human activating signal cointegrator 1 complex subunit 2 (ascc2)

PDB Compounds: (A:) Activating signal cointegrator 1 complex subunit 2

SCOPe Domain Sequences for d2di0a1:

Sequence; same for both SEQRES and ATOM records:

>d2di0a1 a.5.2.4 (A:8-70) Activating signal cointegrator 1 complex subunit 2 {Human (Homo sapiens) [TaxId: 9606]}
mcgveldslisqvkdllpdlgegfilacleyyhydpeqvinnileerlaptlsqldrnld
rem

Timeline for d2di0a1:

• d2di0a1 first appeared in SCOP 1.73
  
• d2di0a1 appears in SCOPe 2.05
  
• d2di0a1 appears in SCOPe 2.07
  
• d2di0a1 appears in the current release, SCOPe 2.08