Lineage for d2di0a1 (2di0 A:8-70)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636335Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 636359Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 636486Family a.5.2.4: CUE domain [88995] (4 proteins)
    Pfam PF02845
  6. 636487Protein Activating signal cointegrator 1 complex subunit 2 [140346] (1 species)
  7. 636488Species Human (Homo sapiens) [TaxId:9606] [140347] (1 PDB entry)
  8. 636489Domain d2di0a1: 2di0 A:8-70 [131521]

Details for d2di0a1

PDB Entry: 2di0 (more details)

PDB Description: solution structure of the cue domain in the human activating signal cointegrator 1 complex subunit 2 (ascc2)
PDB Compounds: (A:) Activating signal cointegrator 1 complex subunit 2

SCOP Domain Sequences for d2di0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2di0a1 a.5.2.4 (A:8-70) Activating signal cointegrator 1 complex subunit 2 {Human (Homo sapiens) [TaxId: 9606]}
mcgveldslisqvkdllpdlgegfilacleyyhydpeqvinnileerlaptlsqldrnld
rem

SCOP Domain Coordinates for d2di0a1:

Click to download the PDB-style file with coordinates for d2di0a1.
(The format of our PDB-style files is described here.)

Timeline for d2di0a1: