Lineage for d2dh1b1 (2dh1 B:1-232)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1307105Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1307253Protein Legume lectin [49904] (23 species)
  7. 1307429Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries)
    Uniprot P02872 24-255
  8. 1307535Domain d2dh1b1: 2dh1 B:1-232 [131518]
    automatically matched to d1bzwa_

Details for d2dh1b1

PDB Entry: 2dh1 (more details), 7.65 Å

PDB Description: Crystal structure of peanut lectin lactose-azobenzene-4,4'-dicarboxylic acid-lactose complex
PDB Compounds: (B:) Galactose-binding lectin

SCOPe Domain Sequences for d2dh1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dh1b1 b.29.1.1 (B:1-232) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOPe Domain Coordinates for d2dh1b1:

Click to download the PDB-style file with coordinates for d2dh1b1.
(The format of our PDB-style files is described here.)

Timeline for d2dh1b1: