![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (4 proteins) |
![]() | Protein Legume lectin [49904] (23 species) |
![]() | Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries) |
![]() | Domain d2dh1b1: 2dh1 B:1-232 [131518] automatically matched to d1bzwa_ |
PDB Entry: 2dh1 (more details), 7.65 Å
SCOP Domain Sequences for d2dh1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dh1b1 b.29.1.1 (B:1-232) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
Timeline for d2dh1b1: