Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.8: HRDC-like [47819] (4 families) |
Family a.60.8.1: HRDC domain from helicases [47820] (2 proteins) |
Protein Werner syndrome ATP-dependent helicase, WRN [140640] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140641] (3 PDB entries) Uniprot Q14191 1140-1239! Uniprot Q14191 1142-1235 |
Domain d2dgza1: 2dgz A:1140-1239 [131516] |
PDB Entry: 2dgz (more details)
SCOP Domain Sequences for d2dgza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dgza1 a.60.8.1 (A:1140-1239) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]} ssqpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrpttvenvk ridgvsegkaamlaplwevikhfcqtnsvqtdlfsstkpq
Timeline for d2dgza1: