Lineage for d2dgxa1 (2dgx A:553-635)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951948Protein Limkain-b1, LKAP [143324] (1 species)
    KIAA0430
  7. 2951949Species Human (Homo sapiens) [TaxId:9606] [143325] (1 PDB entry)
    Uniprot Q9Y4F3 788-870
  8. 2951950Domain d2dgxa1: 2dgx A:553-635 [131515]
    Other proteins in same PDB: d2dgxa2, d2dgxa3

Details for d2dgxa1

PDB Entry: 2dgx (more details)

PDB Description: solution structure of the rna recognition motif in kiaa0430 protein
PDB Compounds: (A:) KIAA0430 protein

SCOPe Domain Sequences for d2dgxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgxa1 d.58.7.1 (A:553-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]}
ngadvqvsnidyrlsrkelqqllqeafarhgkvksvelsphtdyqlkavvqmenlqdaig
avnslhrykigskkilvslatga

SCOPe Domain Coordinates for d2dgxa1:

Click to download the PDB-style file with coordinates for d2dgxa1.
(The format of our PDB-style files is described here.)

Timeline for d2dgxa1: