SCOPe 2.06: Domain d2dgmf_: 2dgm F:

Lineage for d2dgmf_ (2dgm F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
   automatically mapped to Pfam PF00282

6. Protein Glutamate decarboxylase beta, GadB [102596] (2 species)

7. Species Escherichia coli [TaxId:562] [102597] (5 PDB entries)

8. Domain d2dgmf_: 2dgm F: [131513]
   automated match to d1pmob_
   complexed with acy, fmt, iod, peg, plp

Details for d2dgmf_

PDB Entry: 2dgm, 1.95 Å

PDB Description: Crystal structure of Escherichia coli GadB in complex with iodide

PDB Compounds: (F:) Glutamate decarboxylase beta

SCOPe Domain Sequences for d2dgmf_:

Sequence; same for both SEQRES and ATOM records:

>d2dgmf_ c.67.1.6 (F:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]}
kkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlat
fcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtn
tigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipm
rpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhi
daasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfn
vdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgp
yefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmr
imcrrgfemdfaellledykaslkylsdhpklqg

Timeline for d2dgmf_:

• d2dgmf_ first appeared in SCOP 1.73, called d2dgmf1
  
• d2dgmf_ appears in SCOPe 2.05
  
• d2dgmf_ appears in SCOPe 2.07
  
• d2dgmf_ appears in the current release, SCOPe 2.08