Lineage for d2dgme_ (2dgm E:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1176924Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1176925Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1177915Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
  6. 1177926Protein Glutamate decarboxylase beta, GadB [102596] (2 species)
  7. 1177940Species Escherichia coli [TaxId:562] [102597] (5 PDB entries)
  8. 1177957Domain d2dgme_: 2dgm E: [131512]
    automated match to d1pmob_
    complexed with acy, fmt, iod, peg, plp

Details for d2dgme_

PDB Entry: 2dgm (more details), 1.95 Å

PDB Description: Crystal structure of Escherichia coli GadB in complex with iodide
PDB Compounds: (E:) Glutamate decarboxylase beta

SCOPe Domain Sequences for d2dgme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgme_ c.67.1.6 (E:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]}
kkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlat
fcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtn
tigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipm
rpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhi
daasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfn
vdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgp
yefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmr
imcrrgfemdfaellledykaslkylsdhp

SCOPe Domain Coordinates for d2dgme_:

Click to download the PDB-style file with coordinates for d2dgme_.
(The format of our PDB-style files is described here.)

Timeline for d2dgme_: