Lineage for d2dgme1 (2dgm E:4-452)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 706118Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (3 proteins)
  6. 706129Protein Glutamate decarboxylase beta, GadB [102596] (1 species)
  7. 706130Species Escherichia coli [TaxId:562] [102597] (4 PDB entries)
  8. 706141Domain d2dgme1: 2dgm E:4-452 [131512]
    automatically matched to d1pmob_
    complexed with acy, fmt, iod, peg, plp

Details for d2dgme1

PDB Entry: 2dgm (more details), 1.95 Å

PDB Description: Crystal structure of Escherichia coli GadB in complex with iodide
PDB Compounds: (E:) Glutamate decarboxylase beta

SCOP Domain Sequences for d2dgme1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgme1 c.67.1.6 (E:4-452) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]}
kqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatf
cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
mcrrgfemdfaellledykaslkylsdhp

SCOP Domain Coordinates for d2dgme1:

Click to download the PDB-style file with coordinates for d2dgme1.
(The format of our PDB-style files is described here.)

Timeline for d2dgme1: