Lineage for d2dglf1 (2dgl F:4-452)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380885Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
    automatically mapped to Pfam PF00282
  6. 1380896Protein Glutamate decarboxylase beta, GadB [102596] (2 species)
  7. 1380910Species Escherichia coli [TaxId:562] [102597] (5 PDB entries)
  8. 1380940Domain d2dglf1: 2dgl F:4-452 [131507]
    automatically matched to d1pmob_
    complexed with acy, br, plp

Details for d2dglf1

PDB Entry: 2dgl (more details), 3.15 Å

PDB Description: Crystal structure of Escherichia coli GadB in complex with bromide
PDB Compounds: (F:) Glutamate decarboxylase beta

SCOPe Domain Sequences for d2dglf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dglf1 c.67.1.6 (F:4-452) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]}
kqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatf
cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
mcrrgfemdfaellledykaslkylsdhp

SCOPe Domain Coordinates for d2dglf1:

Click to download the PDB-style file with coordinates for d2dglf1.
(The format of our PDB-style files is described here.)

Timeline for d2dglf1: