Lineage for d2dgla_ (2dgl A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504195Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
    automatically mapped to Pfam PF00282
  6. 2504206Protein Glutamate decarboxylase beta, GadB [102596] (2 species)
  7. 2504226Species Escherichia coli [TaxId:562] [102597] (5 PDB entries)
  8. 2504251Domain d2dgla_: 2dgl A: [131502]
    automated match to d3fz7f_
    complexed with acy, br, plp

Details for d2dgla_

PDB Entry: 2dgl (more details), 3.15 Å

PDB Description: Crystal structure of Escherichia coli GadB in complex with bromide
PDB Compounds: (A:) Glutamate decarboxylase beta

SCOPe Domain Sequences for d2dgla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgla_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]}
kkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlat
fcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtn
tigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipm
rpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhi
daasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfn
vdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgp
yefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmr
imcrrgfemdfaellledykaslkylsdhp

SCOPe Domain Coordinates for d2dgla_:

Click to download the PDB-style file with coordinates for d2dgla_.
(The format of our PDB-style files is described here.)

Timeline for d2dgla_: