Class b: All beta proteins [48724] (178 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) |
Family b.68.6.1: SGL-like [63830] (4 proteins) |
Protein automated matches [190602] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [187620] (3 PDB entries) |
Domain d2dg1f2: 2dg1 F:6-325 [131498] Other proteins in same PDB: d2dg1a3, d2dg1b3, d2dg1d3, d2dg1e3, d2dg1f3 automated match to d2dg0a1 complexed with ca, gol |
PDB Entry: 2dg1 (more details), 1.72 Å
SCOPe Domain Sequences for d2dg1f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dg1f2 b.68.6.1 (F:6-325) automated matches {Staphylococcus aureus [TaxId: 1280]} qdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvfe gnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnlq diiedlstayciddmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisvan gialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsddn lyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemgg gsmlytvngfakghqsfqfq
Timeline for d2dg1f2: