SCOPe 2.07: Domain d2dg1e2: 2dg1 E:6-325

Lineage for d2dg1e2 (2dg1 E:6-325)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families)

5. Family b.68.6.1: SGL-like [63830] (4 proteins)

6. Protein automated matches [190602] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [187620] (3 PDB entries)

8. Domain d2dg1e2: 2dg1 E:6-325 [131497]
   Other proteins in same PDB: d2dg1a3, d2dg1b3, d2dg1d3, d2dg1e3, d2dg1f3
   automated match to d2dg0a1
   complexed with ca, gol

Details for d2dg1e2

PDB Entry: 2dg1, 1.72 Å

PDB Description: Crystal structure of Drp35, a 35kDa drug responsive protein from Staphylococcus aureus, complexed with Ca2+

PDB Compounds: (E:) DrP35

SCOPe Domain Sequences for d2dg1e2:

Sequence; same for both SEQRES and ATOM records:

>d2dg1e2 b.68.6.1 (E:6-325) automated matches {Staphylococcus aureus [TaxId: 1280]}
qdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvfe
gnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnlq
diiedlstayciddmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisvan
gialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsddn
lyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemgg
gsmlytvngfakghqsfqfq

Timeline for d2dg1e2:

• d2dg1e2 first appeared in SCOP 1.73, called d2dg1e1
  
• d2dg1e2 appears in SCOPe 2.06
  
• d2dg1e2 appears in the current release, SCOPe 2.08