Lineage for d2dg1d2 (2dg1 D:5-325)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808422Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2808423Family b.68.6.1: SGL-like [63830] (4 proteins)
  6. 2808454Protein automated matches [190602] (2 species)
    not a true protein
  7. 2808470Species Staphylococcus aureus [TaxId:1280] [187620] (3 PDB entries)
  8. 2808474Domain d2dg1d2: 2dg1 D:5-325 [131496]
    Other proteins in same PDB: d2dg1a3, d2dg1b3, d2dg1d3, d2dg1e3, d2dg1f3
    automated match to d2dg0a1
    complexed with ca, gol

Details for d2dg1d2

PDB Entry: 2dg1 (more details), 1.72 Å

PDB Description: Crystal structure of Drp35, a 35kDa drug responsive protein from Staphylococcus aureus, complexed with Ca2+
PDB Compounds: (D:) DrP35

SCOPe Domain Sequences for d2dg1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dg1d2 b.68.6.1 (D:5-325) automated matches {Staphylococcus aureus [TaxId: 1280]}
qqdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvf
egnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnl
qdiiedlstayciddmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisva
ngialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsdd
nlyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemg
ggsmlytvngfakghqsfqfq

SCOPe Domain Coordinates for d2dg1d2:

Click to download the PDB-style file with coordinates for d2dg1d2.
(The format of our PDB-style files is described here.)

Timeline for d2dg1d2: