Class b: All beta proteins [48724] (165 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (2 families) |
Family b.68.6.1: SGL-like [63830] (3 proteins) |
Protein Lactonase Drp35 [141546] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [141547] (3 PDB entries) |
Domain d2dg1c1: 2dg1 C:6-324 [131495] automatically matched to 2DG0 A:5-324 complexed with ca, gol |
PDB Entry: 2dg1 (more details), 1.72 Å
SCOP Domain Sequences for d2dg1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dg1c1 b.68.6.1 (C:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} qdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvfe gnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnlq diiedlstayciddmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisvan gialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsddn lyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemgg gsmlytvngfakghqsfqf
Timeline for d2dg1c1: