Class b: All beta proteins [48724] (176 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) |
Family b.68.6.1: SGL-like [63830] (4 proteins) |
Protein automated matches [190602] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [187620] (3 PDB entries) |
Domain d2dg0k_: 2dg0 K: [131491] Other proteins in same PDB: d2dg0a1 automated match to d2dg0a1 |
PDB Entry: 2dg0 (more details), 2.4 Å
SCOPe Domain Sequences for d2dg0k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dg0k_ b.68.6.1 (K:) automated matches {Staphylococcus aureus [TaxId: 1280]} qqdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvf egnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnl qdiiedlstayciddmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisva ngialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsdd nlyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemg ggsmlytvngfakghqsfqfq
Timeline for d2dg0k_: