![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) ![]() |
![]() | Family b.68.6.1: SGL-like [63830] (4 proteins) |
![]() | Protein automated matches [190602] (2 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [187620] (3 PDB entries) |
![]() | Domain d2dg0g_: 2dg0 G: [131487] Other proteins in same PDB: d2dg0a1, d2dg0a2, d2dg0e3, d2dg0j3 automated match to d2dg0a1 |
PDB Entry: 2dg0 (more details), 2.4 Å
SCOPe Domain Sequences for d2dg0g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dg0g_ b.68.6.1 (G:) automated matches {Staphylococcus aureus [TaxId: 1280]} qdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvfe gnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnlq diiedlstayciddmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisvan gialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsddn lyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemgg gsmlytvngfakghqsfqfq
Timeline for d2dg0g_: