Lineage for d2dg0f1 (2dg0 F:5-324)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674916Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 675157Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (2 families) (S)
  5. 675158Family b.68.6.1: SGL-like [63830] (3 proteins)
  6. 675165Protein Lactonase Drp35 [141546] (1 species)
  7. 675166Species Staphylococcus aureus [TaxId:1280] [141547] (3 PDB entries)
  8. 675184Domain d2dg0f1: 2dg0 F:5-324 [131486]
    automatically matched to 2DG0 A:5-324

Details for d2dg0f1

PDB Entry: 2dg0 (more details), 2.4 Å

PDB Description: Crystal structure of Drp35, a 35kDa drug responsive protein from Staphylococcus aureus
PDB Compounds: (F:) DrP35

SCOP Domain Sequences for d2dg0f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dg0f1 b.68.6.1 (F:5-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}
qqdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvf
egnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnl
qdiiedlstayciddmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisva
ngialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsdd
nlyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemg
ggsmlytvngfakghqsfqf

SCOP Domain Coordinates for d2dg0f1:

Click to download the PDB-style file with coordinates for d2dg0f1.
(The format of our PDB-style files is described here.)

Timeline for d2dg0f1: