Lineage for d2dg0c_ (2dg0 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2417904Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2417905Family b.68.6.1: SGL-like [63830] (4 proteins)
  6. 2417936Protein automated matches [190602] (2 species)
    not a true protein
  7. 2417952Species Staphylococcus aureus [TaxId:1280] [187620] (3 PDB entries)
  8. 2417965Domain d2dg0c_: 2dg0 C: [131483]
    Other proteins in same PDB: d2dg0a1, d2dg0a2, d2dg0e3, d2dg0j3
    automated match to d2dg0a1

Details for d2dg0c_

PDB Entry: 2dg0 (more details), 2.4 Å

PDB Description: Crystal structure of Drp35, a 35kDa drug responsive protein from Staphylococcus aureus
PDB Compounds: (C:) DrP35

SCOPe Domain Sequences for d2dg0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dg0c_ b.68.6.1 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvfe
gnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnlq
diiedlstayciddmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisvan
gialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsddn
lyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemgg
gsmlytvngfakghqsfqfq

SCOPe Domain Coordinates for d2dg0c_:

Click to download the PDB-style file with coordinates for d2dg0c_.
(The format of our PDB-style files is described here.)

Timeline for d2dg0c_: