Lineage for d2dfxe_ (2dfx E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008616Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily)
    alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander
  4. 3008617Superfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families) (S)
  5. 3008624Family d.243.1.2: Colicin E5 nuclease domain [143007] (2 proteins)
  6. 3008635Protein automated matches [190600] (1 species)
    not a true protein
  7. 3008636Species Escherichia coli [TaxId:562] [187618] (2 PDB entries)
  8. 3008637Domain d2dfxe_: 2dfx E: [131480]
    Other proteins in same PDB: d2dfxi1, d2dfxi2
    automated match to d2a8ka1

Details for d2dfxe_

PDB Entry: 2dfx (more details), 1.9 Å

PDB Description: Crystal structure of the carboxy terminal domain of colicin E5 complexed with its inhibitor
PDB Compounds: (E:) Colicin-E5

SCOPe Domain Sequences for d2dfxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dfxe_ d.243.1.2 (E:) automated matches {Escherichia coli [TaxId: 562]}
lkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgrndpatvygspg
kyvvvndrtgevtqisdktdpgwvddsriqwg

SCOPe Domain Coordinates for d2dfxe_:

Click to download the PDB-style file with coordinates for d2dfxe_.
(The format of our PDB-style files is described here.)

Timeline for d2dfxe_: