Lineage for d2dftd_ (2dft D:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
    automatically mapped to Pfam PF01202
  6. Protein Shikimate kinase (AroK) [52567] (4 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [75194] (11 PDB entries)
    Uniprot P95014
  8. Domain d2dftd_: 2dft D: [131479]
    automated match to d1l4ua_
    complexed with adp, cl, mg

Details for d2dftd_

PDB Entry: 2dft (more details), 2.8 Å

PDB Description: Structure of shikimate kinase from Mycobacterium tuberculosis complexed with ADP and Mg at 2.8 angstrons of resolution
PDB Compounds: (D:) Shikimate kinase

SCOPe Domain Sequences for d2dftd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dftd_ c.37.1.2 (D:) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrl

SCOPe Domain Coordinates for d2dftd_ are not available.

Timeline for d2dftd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dfta_, d2dftb_, d2dftc_