Lineage for d2dfkb_ (2dfk B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846020Protein CDC42 [52619] (2 species)
  7. 1846021Species Human (Homo sapiens) [TaxId:9606] [52620] (28 PDB entries)
  8. 1846024Domain d2dfkb_: 2dfk B: [131473]
    Other proteins in same PDB: d2dfka1, d2dfka2, d2dfkc1, d2dfkc2
    automated match to d1doaa_
    complexed with gol, so4

Details for d2dfkb_

PDB Entry: 2dfk (more details), 2.15 Å

PDB Description: Crystal structure of the CDC42-Collybistin II complex
PDB Compounds: (B:) cell division cycle 42 isoform 1

SCOPe Domain Sequences for d2dfkb_:

Sequence, based on SEQRES records: (download)

>d2dfkb_ c.37.1.8 (B:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkksrrcvll

Sequence, based on observed residues (ATOM records): (download)

>d2dfkb_ c.37.1.8 (B:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepk
srrcvll

SCOPe Domain Coordinates for d2dfkb_:

Click to download the PDB-style file with coordinates for d2dfkb_.
(The format of our PDB-style files is described here.)

Timeline for d2dfkb_: