![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein CDC42 [52619] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52620] (18 PDB entries) |
![]() | Domain d2dfkb1: 2dfk B:1-187 [131473] automatically matched to d1aje__ complexed with gol, so4 |
PDB Entry: 2dfk (more details), 2.15 Å
SCOP Domain Sequences for d2dfkb1:
Sequence, based on SEQRES records: (download)
>d2dfkb1 c.37.1.8 (B:1-187) CDC42 {Human (Homo sapiens) [TaxId: 9606]} mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp epkksrr
>d2dfkb1 c.37.1.8 (B:1-187) CDC42 {Human (Homo sapiens) [TaxId: 9606]} mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepk srr
Timeline for d2dfkb1: