Lineage for d2dfkb1 (2dfk B:1-187)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 695700Protein CDC42 [52619] (1 species)
  7. 695701Species Human (Homo sapiens) [TaxId:9606] [52620] (18 PDB entries)
  8. 695704Domain d2dfkb1: 2dfk B:1-187 [131473]
    automatically matched to d1aje__
    complexed with gol, so4

Details for d2dfkb1

PDB Entry: 2dfk (more details), 2.15 Å

PDB Description: Crystal structure of the CDC42-Collybistin II complex
PDB Compounds: (B:) cell division cycle 42 isoform 1

SCOP Domain Sequences for d2dfkb1:

Sequence, based on SEQRES records: (download)

>d2dfkb1 c.37.1.8 (B:1-187) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkksrr

Sequence, based on observed residues (ATOM records): (download)

>d2dfkb1 c.37.1.8 (B:1-187) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepk
srr

SCOP Domain Coordinates for d2dfkb1:

Click to download the PDB-style file with coordinates for d2dfkb1.
(The format of our PDB-style files is described here.)

Timeline for d2dfkb1: