Lineage for d2dfha_ (2dfh A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2139125Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2139371Protein automated matches [190266] (7 species)
    not a true protein
  7. 2139395Species Thermococcus kodakarensis [TaxId:69014] [187055] (3 PDB entries)
  8. 2139396Domain d2dfha_: 2dfh A: [131472]
    automated match to d1io2a_

Details for d2dfha_

PDB Entry: 2dfh (more details), 2.27 Å

PDB Description: Crystal structure of Tk-RNase HII(1-212)-C
PDB Compounds: (A:) ribonuclease hii

SCOPe Domain Sequences for d2dfha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dfha_ c.55.3.1 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl
ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge
rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl
enyyrehgefppivrkgwktlkkiaekvesektqdminkst

SCOPe Domain Coordinates for d2dfha_:

Click to download the PDB-style file with coordinates for d2dfha_.
(The format of our PDB-style files is described here.)

Timeline for d2dfha_: