SCOPe 2.02: Domain d2dfca_: 2dfc A:

Lineage for d2dfca_ (2dfc A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (17 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma reesei, xynII [TaxId:51453] [49985] (11 PDB entries)

8. Domain d2dfca_: 2dfc A: [131471]
   automated match to d1enxa_
   complexed with iod

Details for d2dfca_

PDB Entry: 2dfc, 1.19 Å

PDB Description: xylanase ii from tricoderma reesei at 293k

PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d2dfca_:

Sequence; same for both SEQRES and ATOM records:

>d2dfca_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

Timeline for d2dfca_:

• d2dfca_ first appeared in SCOP 1.73, called d2dfca1
  
• d2dfca_ appears in SCOPe 2.01
  
• d2dfca_ appears in SCOPe 2.03
  
• d2dfca_ appears in the current release, SCOPe 2.08