Lineage for d2dfca1 (2dfc A:1-190)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664069Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 664114Protein Xylanase II [49979] (16 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 664181Species Trichoderma reesei, xynII [TaxId:51453] [49985] (10 PDB entries)
  8. 664183Domain d2dfca1: 2dfc A:1-190 [131471]
    automatically matched to d1enxa_
    complexed with iod

Details for d2dfca1

PDB Entry: 2dfc (more details), 1.19 Å

PDB Description: Xylanase II from Tricoderma reesei at 293K
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOP Domain Sequences for d2dfca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dfca1 b.29.1.11 (A:1-190) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOP Domain Coordinates for d2dfca1:

Click to download the PDB-style file with coordinates for d2dfca1.
(The format of our PDB-style files is described here.)

Timeline for d2dfca1: