Lineage for d2dfaa1 (2dfa A:1-250)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689534Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 689577Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (7 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 689651Family c.6.2.5: LamB/YcsF-like [117449] (3 proteins)
    Pfam PF03746
  6. 689655Protein Hypothetical protein TTHB195 [141963] (1 species)
  7. 689656Species Thermus thermophilus [TaxId:274] [141964] (1 PDB entry)
  8. 689657Domain d2dfaa1: 2dfa A:1-250 [131469]

Details for d2dfaa1

PDB Entry: 2dfa (more details), 1.9 Å

PDB Description: Crystal Structure of Lactam Utilization Protein from Thermus thermophilus HB8
PDB Compounds: (A:) Hypothetical UPF0271 protein TTHB195

SCOP Domain Sequences for d2dfaa1:

Sequence, based on SEQRES records: (download)

>d2dfaa1 c.6.2.5 (A:1-250) Hypothetical protein TTHB195 {Thermus thermophilus [TaxId: 274]}
mkvdlnadagesygafayghdreifplvssanlacgfhggspgrileavrlakahgvavg
ahpgfpdlvgfgrremalspeevyadvlyqigalsaflkaeglplhhvkphgalylkacr
dretaraialavkafdpglplvvlpgtvyeeearkaglrvvleafperaylrsgqlaprs
mpgswitdpeeaarralrmvlegkvealdggevavradtlcihgdnpnapevaravreal
eqagvevraf

Sequence, based on observed residues (ATOM records): (download)

>d2dfaa1 c.6.2.5 (A:1-250) Hypothetical protein TTHB195 {Thermus thermophilus [TaxId: 274]}
mkvdlnadagesygafayghdreifplvssanlacgfhggspgrileavrlakahgvavg
ahpgfpdlvgfgrremalspeevyadvlyqigalsaflkaeglplhhvkphgalylkacr
dretaraialavkafdpglplvvlpgtvyeeearkaglrvvleafperaylrsgqlaprs
mpgswitdpeeaarralrmvlegkvealdggevavradtlcihpnapevaravrealeqa
gvevraf

SCOP Domain Coordinates for d2dfaa1:

Click to download the PDB-style file with coordinates for d2dfaa1.
(The format of our PDB-style files is described here.)

Timeline for d2dfaa1: