SCOP 1.73: Domain d2df7t1: 2df7 T:11-428

Lineage for d2df7t1 (2df7 T:11-428)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (9 families)

5. Family b.121.4.9: Birnaviridae-like VP [141109] (1 protein)
   dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses; includes Pfam PF01766; Birnavirus VP2 protein

6. Protein Birnavirus VP2 [141110] (1 species)
   Link between +sRNA and dsRNA viruses two domains - the first similar to scop_sf 88633 and the second, insert domain is similar to scop_sf 49818. dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses

7. Species Infectious bursal disease virus [TaxId:10995] [141111] (3 PDB entries)

8. Domain d2df7t1: 2df7 T:11-428 [131468]
   automatically matched to 2DF7 A:11-429
   complexed with ca, cl

Details for d2df7t1

PDB Entry: 2df7, 2.6 Å

PDB Description: crystal structure of infectious bursal disease virus vp2 subviral particle

PDB Compounds: (T:) structural polyprotein VP2

SCOP Domain Sequences for d2df7t1:

Sequence; same for both SEQRES and ATOM records:

>d2df7t1 b.121.4.9 (T:11-428) Birnavirus VP2 {Infectious bursal disease virus [TaxId: 10995]}
ivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivga
hytlqsngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfq
gslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigld
pkmvatcdssdrprvytitaaddyqfssqyqsggvtitlfsanidaitslsiggelvfht
svhglaldatiyligfdgttvitravasdnglttgidnlmpfnlviptneitqpitsikl
eivtsksggqagdqmswsasgslavtihggnypgalrpvtlvayervatgsvvtvagvsn
felipnpelaknlvteygrfdpgamnytklilsererlgiktvwptreytdfreyfme

Timeline for d2df7t1:

• d2df7t1 is new in SCOP 1.73
  
• d2df7t1 appears in SCOP 1.75
  
• d2df7t1 appears in the current release, SCOPe 2.08, called d2df7t_