Lineage for d2df7t_ (2df7 T:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822486Family b.121.4.9: Birnaviridae-like VP [141109] (2 proteins)
    dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses; includes Pfam PF01766; Birnavirus VP2 protein
  6. 2822492Protein automated matches [190599] (2 species)
    not a true protein
  7. 2822495Species Infectious bursal disease virus [TaxId:10995] [187617] (2 PDB entries)
  8. 2822514Domain d2df7t_: 2df7 T: [131468]
    Other proteins in same PDB: d2df7a1
    automated match to d2gsya1
    complexed with ca, cl

Details for d2df7t_

PDB Entry: 2df7 (more details), 2.6 Å

PDB Description: crystal structure of infectious bursal disease virus vp2 subviral particle
PDB Compounds: (T:) structural polyprotein VP2

SCOPe Domain Sequences for d2df7t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2df7t_ b.121.4.9 (T:) automated matches {Infectious bursal disease virus [TaxId: 10995]}
ivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivga
hytlqsngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfq
gslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigld
pkmvatcdssdrprvytitaaddyqfssqyqsggvtitlfsanidaitslsiggelvfht
svhglaldatiyligfdgttvitravasdnglttgidnlmpfnlviptneitqpitsikl
eivtsksggqagdqmswsasgslavtihggnypgalrpvtlvayervatgsvvtvagvsn
felipnpelaknlvteygrfdpgamnytklilsererlgiktvwptreytdfreyfme

SCOPe Domain Coordinates for d2df7t_:

Click to download the PDB-style file with coordinates for d2df7t_.
(The format of our PDB-style files is described here.)

Timeline for d2df7t_: