Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.9: Birnaviridae-like VP [141109] (2 proteins) dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses; includes Pfam PF01766; Birnavirus VP2 protein |
Protein automated matches [190599] (2 species) not a true protein |
Species Infectious bursal disease virus [TaxId:10995] [187617] (2 PDB entries) |
Domain d2df7m_: 2df7 M: [131461] Other proteins in same PDB: d2df7a1 automated match to d2gsya1 complexed with ca, cl |
PDB Entry: 2df7 (more details), 2.6 Å
SCOPe Domain Sequences for d2df7m_:
Sequence, based on SEQRES records: (download)
>d2df7m_ b.121.4.9 (M:) automated matches {Infectious bursal disease virus [TaxId: 10995]} vpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgah ytlqsngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqg slseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldp kmvatcdssdrprvytitaaddyqfssqyqsggvtitlfsanidaitslsiggelvfhts vhglaldatiyligfdgttvitravasdnglttgidnlmpfnlviptneitqpitsikle ivtsksggqagdqmswsasgslavtihggnypgalrpvtlvayervatgsvvtvagvsnf elipnpelaknlvteygrfdpgamnytklilsererlgiktvwptreytdfreyfme
>d2df7m_ b.121.4.9 (M:) automated matches {Infectious bursal disease virus [TaxId: 10995]} vpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgah ytlqsngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgslsel tdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpkmvat cdssdrprvytitaaddyqfssqyqsggvtitlfsanidaitslsiggelvfhtsvhgla ldatiyligfdgttvitravasdnglttgidnlmpfnlviptneitqpitsikleivtsk sggqagdqmswsasgslavtihggnypgalrpvtlvayervatgsvvtvagvsnfelipn pelaknlvteygrfdpgamnytklilsererlgiktvwptreytdfreyfme
Timeline for d2df7m_: