Lineage for d2df7b1 (2df7 B:12-429)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679605Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 679742Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (9 families) (S)
  5. 680175Family b.121.4.9: Birnaviridae-like VP [141109] (1 protein)
    dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses; includes Pfam PF01766; Birnavirus VP2 protein
  6. 680176Protein Birnavirus VP2 [141110] (1 species)
    Link between +sRNA and dsRNA viruses two domains - the first similar to scop_sf 88633 and the second, insert domain is similar to scop_sf 49818. dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses
  7. 680177Species Infectious bursal disease virus [TaxId:10995] [141111] (3 PDB entries)
  8. 680180Domain d2df7b1: 2df7 B:12-429 [131450]
    automatically matched to 2DF7 A:11-429
    complexed with ca, cl

Details for d2df7b1

PDB Entry: 2df7 (more details), 2.6 Å

PDB Description: crystal structure of infectious bursal disease virus vp2 subviral particle
PDB Compounds: (B:) structural polyprotein VP2

SCOP Domain Sequences for d2df7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2df7b1 b.121.4.9 (B:12-429) Birnavirus VP2 {Infectious bursal disease virus [TaxId: 10995]}
vpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgah
ytlqsngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqg
slseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldp
kmvatcdssdrprvytitaaddyqfssqyqsggvtitlfsanidaitslsiggelvfhts
vhglaldatiyligfdgttvitravasdnglttgidnlmpfnlviptneitqpitsikle
ivtsksggqagdqmswsasgslavtihggnypgalrpvtlvayervatgsvvtvagvsnf
elipnpelaknlvteygrfdpgamnytklilsererlgiktvwptreytdfreyfmev

SCOP Domain Coordinates for d2df7b1:

Click to download the PDB-style file with coordinates for d2df7b1.
(The format of our PDB-style files is described here.)

Timeline for d2df7b1: