Class b: All beta proteins [48724] (165 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (9 families) |
Family b.121.4.9: Birnaviridae-like VP [141109] (1 protein) dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses; includes Pfam PF01766; Birnavirus VP2 protein |
Protein Birnavirus VP2 [141110] (1 species) Link between +sRNA and dsRNA viruses two domains - the first similar to scop_sf 88633 and the second, insert domain is similar to scop_sf 49818. dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses |
Species Infectious bursal disease virus [TaxId:10995] [141111] (3 PDB entries) |
Domain d2df7b1: 2df7 B:12-429 [131450] automatically matched to 2DF7 A:11-429 complexed with ca, cl |
PDB Entry: 2df7 (more details), 2.6 Å
SCOP Domain Sequences for d2df7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2df7b1 b.121.4.9 (B:12-429) Birnavirus VP2 {Infectious bursal disease virus [TaxId: 10995]} vpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgah ytlqsngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqg slseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldp kmvatcdssdrprvytitaaddyqfssqyqsggvtitlfsanidaitslsiggelvfhts vhglaldatiyligfdgttvitravasdnglttgidnlmpfnlviptneitqpitsikle ivtsksggqagdqmswsasgslavtihggnypgalrpvtlvayervatgsvvtvagvsnf elipnpelaknlvteygrfdpgamnytklilsererlgiktvwptreytdfreyfmev
Timeline for d2df7b1: