SCOPe 2.07: Domain d2df7a1: 2df7 A:11-429

Lineage for d2df7a1 (2df7 A:11-429)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.9: Birnaviridae-like VP [141109] (2 proteins)
   dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses; includes Pfam PF01766; Birnavirus VP2 protein

6. Protein Birnavirus VP2 [141110] (1 species)
   Link between +sRNA and dsRNA viruses two domains - the first similar to (88633) and the second, insert domain is similar to (49818). dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses

7. Species Infectious bursal disease virus [TaxId:10995] [141111] (3 PDB entries)
   Uniprot P15480 11-431! Uniprot P61825 8-440! Uniprot Q6S9I7 11-429

8. Domain d2df7a1: 2df7 A:11-429 [131449]
   Other proteins in same PDB: d2df7b_, d2df7c_, d2df7d_, d2df7e_, d2df7f_, d2df7g_, d2df7h_, d2df7i_, d2df7j_, d2df7k_, d2df7l_, d2df7m_, d2df7n_, d2df7o_, d2df7p_, d2df7q_, d2df7r_, d2df7s_, d2df7t_
   complexed with ca, cl

Details for d2df7a1

PDB Entry: 2df7, 2.6 Å

PDB Description: crystal structure of infectious bursal disease virus vp2 subviral particle

PDB Compounds: (A:) structural polyprotein VP2

SCOPe Domain Sequences for d2df7a1:

Sequence; same for both SEQRES and ATOM records:

>d2df7a1 b.121.4.9 (A:11-429) Birnavirus VP2 {Infectious bursal disease virus [TaxId: 10995]}
ivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivga
hytlqsngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfq
gslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigld
pkmvatcdssdrprvytitaaddyqfssqyqsggvtitlfsanidaitslsiggelvfht
svhglaldatiyligfdgttvitravasdnglttgidnlmpfnlviptneitqpitsikl
eivtsksggqagdqmswsasgslavtihggnypgalrpvtlvayervatgsvvtvagvsn
felipnpelaknlvteygrfdpgamnytklilsererlgiktvwptreytdfreyfmev

Timeline for d2df7a1:

• d2df7a1 first appeared in SCOP 1.73
  
• d2df7a1 appears in SCOPe 2.06
  
• d2df7a1 appears in the current release, SCOPe 2.08