| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family) ![]() |
| Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein) Pfam PF02686 |
| Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (2 species) |
| Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries) Uniprot P68807 2-100 |
| Domain d2df4c1: 2df4 C:2-100 [131448] Other proteins in same PDB: d2df4a1, d2df4b1, d2df4b2 protein/RNA complex; complexed with mn |
PDB Entry: 2df4 (more details), 3.2 Å
SCOPe Domain Sequences for d2df4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2df4c1 a.137.12.1 (C:2-100) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]}
tkvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqn
vlredkaikgipqelalknaketedgqfkvptimneeda
Timeline for d2df4c1: