Lineage for d2df4c1 (2df4 C:2-100)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750858Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1751074Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family) (S)
  5. 1751075Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein)
    Pfam PF02686
  6. 1751076Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (2 species)
  7. 1751077Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries)
    Uniprot P68807 2-100
  8. 1751081Domain d2df4c1: 2df4 C:2-100 [131448]
    Other proteins in same PDB: d2df4a1, d2df4b1, d2df4b2
    protein/RNA complex; complexed with mn

Details for d2df4c1

PDB Entry: 2df4 (more details), 3.2 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB complexed with Mn2+
PDB Compounds: (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

SCOPe Domain Sequences for d2df4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2df4c1 a.137.12.1 (C:2-100) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]}
tkvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqn
vlredkaikgipqelalknaketedgqfkvptimneeda

SCOPe Domain Coordinates for d2df4c1:

Click to download the PDB-style file with coordinates for d2df4c1.
(The format of our PDB-style files is described here.)

Timeline for d2df4c1: