Lineage for d2df4b2 (2df4 B:2-293)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581287Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2581288Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2581547Family d.128.1.5: GatB/GatE catalytic domain-like [143812] (2 proteins)
    N-terminal and C-terminal parts correspond to Pfam PF02934 (GatB_N) and Pfam PF01162 (GatB), respectively
  6. 2581548Protein Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain [143813] (1 species)
  7. 2581549Species Staphylococcus aureus [TaxId:1280] [143814] (5 PDB entries)
    Uniprot P64201 2-293
  8. 2581553Domain d2df4b2: 2df4 B:2-293 [131447]
    Other proteins in same PDB: d2df4a1, d2df4b1, d2df4c1
    protein/RNA complex; complexed with mn

Details for d2df4b2

PDB Entry: 2df4 (more details), 3.2 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB complexed with Mn2+
PDB Compounds: (B:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B

SCOPe Domain Sequences for d2df4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2df4b2 d.128.1.5 (B:2-293) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
hfetviglevhvelktdskmfspspahfgaepnsntnvidlaypgvlpvvnkravdwamr
aamalnmeiateskfdrknyfypdnpkayqisqfdqpigengyidievdgetkrigitrl
hmeedagksthkgeyslvdlnrqgtplieivsepdirspkeayayleklrsiiqytgvsd
vkmeegslrcdanislrpygqekfgtkaelknlnsfnyvrkgleyeekrqeeellnggei
gqetrrfdestgktilmrvkegsddyryfpepdivplyiddawkervrqtip

SCOPe Domain Coordinates for d2df4b2:

Click to download the PDB-style file with coordinates for d2df4b2.
(The format of our PDB-style files is described here.)

Timeline for d2df4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2df4b1