Lineage for d2df3a1 (2df3 A:24-144)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783673Protein N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) [89176] (1 species)
  7. 783674Species Human (Homo sapiens) [TaxId:9606] [89177] (6 PDB entries)
  8. 783679Domain d2df3a1: 2df3 A:24-144 [131444]
    automatically matched to d1o7va_
    complexed with cys, gal, nag, sia

Details for d2df3a1

PDB Entry: 2df3 (more details), 1.9 Å

PDB Description: the structure of siglec-7 in complex with alpha(2,3)/alpha(2,6) disialyl lactotetraosyl 2-(trimethylsilyl)ethyl
PDB Compounds: (A:) Sialic acid-binding Ig-like lectin 7

SCOP Domain Sequences for d2df3a1:

Sequence, based on SEQRES records: (download)

>d2df3a1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]}
kdysltmqssvtvqegmcvhvrcsfsypvdsqtdsdpvhgywfragndiswkapvatnnp
awavqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnv
t

Sequence, based on observed residues (ATOM records): (download)

>d2df3a1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]}
kdysltmqssvtvqegmcvhvrcsfsypvtdsdpvhgywfraswkapvatnnpawavqee
trdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnvt

SCOP Domain Coordinates for d2df3a1:

Click to download the PDB-style file with coordinates for d2df3a1.
(The format of our PDB-style files is described here.)

Timeline for d2df3a1: