SCOP 1.73: Domain d2df3a1: 2df3 A:24-144

Lineage for d2df3a1 (2df3 A:24-144)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) [89176] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89177] (6 PDB entries)

8. Domain d2df3a1: 2df3 A:24-144 [131444]
   automatically matched to d1o7va_
   complexed with cys, gal, nag, sia

Details for d2df3a1

PDB Entry: 2df3, 1.9 Å

PDB Description: the structure of siglec-7 in complex with alpha(2,3)/alpha(2,6) disialyl lactotetraosyl 2-(trimethylsilyl)ethyl

PDB Compounds: (A:) Sialic acid-binding Ig-like lectin 7

SCOP Domain Sequences for d2df3a1:

Sequence, based on SEQRES records:

>d2df3a1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]}
kdysltmqssvtvqegmcvhvrcsfsypvdsqtdsdpvhgywfragndiswkapvatnnp
awavqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnv
t

Sequence, based on observed residues (ATOM records):

>d2df3a1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]}
kdysltmqssvtvqegmcvhvrcsfsypvtdsdpvhgywfraswkapvatnnpawavqee
trdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnvt

Timeline for d2df3a1:

• d2df3a1 is new in SCOP 1.73
  
• d2df3a1 appears in SCOP 1.75
  
• d2df3a1 appears in the current release, SCOPe 2.08, called d2df3a_