SCOPe 2.08: Domain d2df3a_: 2df3 A:

Lineage for d2df3a_ (2df3 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) [89176] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89177] (6 PDB entries)

8. Domain d2df3a_: 2df3 A: [131444]
   automated match to d1o7va_
   complexed with cys, nag

Details for d2df3a_

PDB Entry: 2df3, 1.9 Å

PDB Description: the structure of siglec-7 in complex with alpha(2,3)/alpha(2,6) disialyl lactotetraosyl 2-(trimethylsilyl)ethyl

PDB Compounds: (A:) Sialic acid-binding Ig-like lectin 7

SCOPe Domain Sequences for d2df3a_:

Sequence, based on SEQRES records:

>d2df3a_ b.1.1.1 (A:) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]}
kdysltmqssvtvqegmcvhvrcsfsypvdsqtdsdpvhgywfragndiswkapvatnnp
awavqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnv
t

Sequence, based on observed residues (ATOM records):

>d2df3a_ b.1.1.1 (A:) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]}
kdysltmqssvtvqegmcvhvrcsfsypvtdsdpvhgywfraswkapvatnnpawavqee
trdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnvt

Timeline for d2df3a_:

• d2df3a_ first appeared in SCOP 1.73, called d2df3a1
  
• d2df3a_ appears in SCOPe 2.07