![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
![]() | Superfamily d.126.1: Pentein [55909] (8 families) ![]() |
![]() | Family d.126.1.5: Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111152] (1 protein) # functionally related to the amidinotransferase, similar active sites automatically mapped to Pfam PF03068 |
![]() | Protein Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111153] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111154] (7 PDB entries) Uniprot Q9UM07 |
![]() | Domain d2deyx3: 2dey X:294-663 [131441] Other proteins in same PDB: d2deyx1, d2deyx2 automatically matched to d1wd8a3 complexed with ca, so4 |
PDB Entry: 2dey (more details), 2.25 Å
SCOPe Domain Sequences for d2deyx3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2deyx3 d.126.1.5 (X:294-663) Peptidylarginine deiminase Pad4, catalytic C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} apwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdeme igyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlevs ppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghvd eflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsnk tlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvlg khlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhagtnvrrkp fsfkwwnmvp
Timeline for d2deyx3: