SCOPe 2.07: Domain d2deyx1: 2dey X:113-293

Lineage for d2deyx1 (2dey X:113-293)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families)
   automatically mapped to Pfam PF08527

5. Family b.2.9.1: Peptidylarginine deiminase Pad4, middle domain [110084] (1 protein)

6. Protein Peptidylarginine deiminase Pad4, middle domain [110085] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110086] (17 PDB entries)
   Uniprot Q9UM07

8. Domain d2deyx1: 2dey X:113-293 [131439]
   Other proteins in same PDB: d2deyx2, d2deyx3
   automatically matched to d1wd8a1
   complexed with ca, so4

Details for d2deyx1

PDB Entry: 2dey, 2.25 Å

PDB Description: crystal structure of human peptidylarginine deiminase 4 in complex with histone h4 n-terminal tail including arg3

PDB Compounds: (X:) Protein-arginine deiminase type IV

SCOPe Domain Sequences for d2deyx1:

Sequence, based on SEQRES records:

>d2deyx1 b.2.9.1 (X:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl
dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk
wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr
v

Sequence, based on observed residues (ATOM records):

>d2deyx1 b.2.9.1 (X:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkqrtwtwgpcgqgaillvncdrdnlessamdceddevldsedlqdms
lmtlstktpkdfftnhtlvlhvarsemdkvrvfqatcsvvlgpkwpshylmvpggkhnmd
fyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfrv

Timeline for d2deyx1:

• d2deyx1 first appeared in SCOP 1.73
  
• d2deyx1 appears in SCOPe 2.06
  
• d2deyx1 appears in the current release, SCOPe 2.08