Lineage for d2dekb1 (2dek B:1-265)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710141Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 710142Superfamily c.90.1: Tetrapyrrole methylase [53790] (1 family) (S)
  5. 710143Family c.90.1.1: Tetrapyrrole methylase [53791] (7 proteins)
    Pfam PF00590
  6. 710148Protein Diphthine synthase, DphB [102684] (3 species)
    diphthamide biosynthesis methyltransferase
  7. 710154Species Pyrococcus horikoshii [TaxId:53953] [142779] (3 PDB entries)
  8. 710156Domain d2dekb1: 2dek B:1-265 [131431]
    automatically matched to 1VCE A:1-265
    complexed with na, sah

Details for d2dekb1

PDB Entry: 2dek (more details), 1.65 Å

PDB Description: Crystal structure of project ID PH0725 from Pyrococcus horikoshii OT3 at 1.65 A resolution
PDB Compounds: (B:) Probable diphthine synthase

SCOP Domain Sequences for d2dekb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dekb1 c.90.1.1 (B:1-265) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]}
mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
klhiveaeylveiagapreilrvnv

SCOP Domain Coordinates for d2dekb1:

Click to download the PDB-style file with coordinates for d2dekb1.
(The format of our PDB-style files is described here.)

Timeline for d2dekb1: