Lineage for d2deaa1 (2dea A:1-291)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 703083Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 703198Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)
  6. 703209Protein Aminopeptidase [53205] (2 species)
  7. 703210Species Aeromonas proteolytica [TaxId:671] [53206] (11 PDB entries)
    synonym: Vibrio proteolyticus
  8. 703213Domain d2deaa1: 2dea A:1-291 [131429]
    automatically matched to d1amp__
    complexed with na, zn

Details for d2deaa1

PDB Entry: 2dea (more details), 1.24 Å

PDB Description: Crystal Structure of the Aminopeptidase of Aeromonas proteolytica at pH 4.7
PDB Compounds: (A:) Bacterial leucyl aminopeptidase

SCOP Domain Sequences for d2deaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2deaa1 c.56.5.4 (A:1-291) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

SCOP Domain Coordinates for d2deaa1:

Click to download the PDB-style file with coordinates for d2deaa1.
(The format of our PDB-style files is described here.)

Timeline for d2deaa1: