| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
| Protein Terminal oxygenase component of carbazole CarAa [143827] (1 species) |
| Species Janthinobacterium sp. J3 [TaxId:213804] [143828] (4 PDB entries) Uniprot Q84II6 143-384 |
| Domain d2de7c2: 2de7 C:143-384 [131426] Other proteins in same PDB: d2de7a1, d2de7a3, d2de7b1, d2de7b3, d2de7c1, d2de7c3 automatically matched to 1WW9 A:143-384 complexed with 9ca, fe2, fes |
PDB Entry: 2de7 (more details), 2 Å
SCOPe Domain Sequences for d2de7c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2de7c2 d.129.3.3 (C:143-384) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]}
pplardtppnfldddmeilgknqiiksnwrlavengfdpshiyihkdsilvkdndlalpl
gfapggdrkqqtrvvdddvvgrkgvydligehgvpvfegtiggevvregaygekivandi
siwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtlgkpcandeerkkyeqefeskwk
pmalegfnnddiwareamvdfyaddkgwvneilfesdeaivawrklasehnqgiqtqahv
sg
Timeline for d2de7c2: