Class b: All beta proteins [48724] (174 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
Protein Terminal oxygenase component of carbazole CarAa [141184] (1 species) |
Species Janthinobacterium sp. J3 [TaxId:213804] [141185] (4 PDB entries) Uniprot Q84II6 1-142 |
Domain d2de7c1: 2de7 C:1-142 [131425] Other proteins in same PDB: d2de7a2, d2de7b2, d2de7c2 automatically matched to 1WW9 A:1-142 complexed with 9ca, fe2, fes |
PDB Entry: 2de7 (more details), 2 Å
SCOPe Domain Sequences for d2de7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2de7c1 b.33.1.2 (C:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]} manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk lktypvqeakgcvfiylgdgdp
Timeline for d2de7c1:
View in 3D Domains from other chains: (mouse over for more information) d2de7a1, d2de7a2, d2de7b1, d2de7b2 |