![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
![]() | Protein Terminal oxygenase component of carbazole CarAa [141184] (1 species) |
![]() | Species Janthinobacterium sp. J3 [TaxId:213804] [141185] (4 PDB entries) Uniprot Q84II6 1-142 |
![]() | Domain d2de7c1: 2de7 C:1-142 [131425] Other proteins in same PDB: d2de7a2, d2de7a3, d2de7b2, d2de7b3, d2de7c2, d2de7c3 automatically matched to 1WW9 A:1-142 complexed with 9ca, fe2, fes |
PDB Entry: 2de7 (more details), 2 Å
SCOPe Domain Sequences for d2de7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2de7c1 b.33.1.2 (C:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]} manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk lktypvqeakgcvfiylgdgdp
Timeline for d2de7c1: