Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
Protein Terminal oxygenase component of carbazole CarAa [143827] (1 species) |
Species Janthinobacterium sp. J3 [TaxId:213804] [143828] (4 PDB entries) Uniprot Q84II6 143-384 |
Domain d2de7a2: 2de7 A:143-384 [131422] Other proteins in same PDB: d2de7a1, d2de7b1, d2de7c1 automatically matched to 1WW9 A:143-384 complexed with 9ca, fe2, fes |
PDB Entry: 2de7 (more details), 2 Å
SCOPe Domain Sequences for d2de7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2de7a2 d.129.3.3 (A:143-384) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]} pplardtppnfldddmeilgknqiiksnwrlavengfdpshiyihkdsilvkdndlalpl gfapggdrkqqtrvvdddvvgrkgvydligehgvpvfegtiggevvregaygekivandi siwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtlgkpcandeerkkyeqefeskwk pmalegfnnddiwareamvdfyaddkgwvneilfesdeaivawrklasehnqgiqtqahv sg
Timeline for d2de7a2:
View in 3D Domains from other chains: (mouse over for more information) d2de7b1, d2de7b2, d2de7c1, d2de7c2 |